Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-8 protein (GJA8)

This Recombinant Human Gap junction alpha-8 protein (GJA8) spans the amino acid sequence from region 2-433.

Product Specifications

Product Name Alternative

Gap junction alpha-8 protein, Connexin-50, Cx50, Lens fiber protein MP70

UniProt

P48165

Expression Region

2-433

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGC ENVCYDEAFPISHIRLWVLQIIFVSTPSLMYVGHAVHYVRMEEKRKSREAEELGQQAGTN GGPDQGSVKKSSGSKGTKKFRLEGTLLRTYICHIIFKTLFEVGFIVGHYFLYGFRILPLY RCSRWPCPNVVDCFVSRPTEKTIFILFMLSVASVSLFLNVMELGHLGLKGIRSALKRPVE QPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFE EKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQ EKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLSK ASSRARSDDLTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WFDC6 sgRNA CRISPR Lentivector (Human) (Target 2)
K2637803 1.0 µg DNA

WFDC6 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
SRC Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-10604R-PE-Cy5.5 100 µL

SRC Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
GLIS1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
21606124 3x 1.0µg DNA

GLIS1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Taar7a Recombinant Protein (Mouse)
RP176978 100 µg

Taar7a Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Ubiquitin Antibody, Clone FK1: ATTO 390
SMC-213D-A390 100 µg

Ubiquitin Antibody, Clone FK1: ATTO 390

Sign In for Pricing
View Details
OR6M1 Rabbit Polyclonal Antibody (FITC)
orb2085513 100 µL

OR6M1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details