Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Innexin inx7 (inx7)

This Recombinant Drosophila melanogaster Innexin inx7 (inx7) spans the amino acid sequence from region 1-438.

Product Specifications

Product Name Alternative

Innexin inx7, Innexin-7, Gap junction protein prp7, Pas-related protein 7

UniProt

Q9V3W6

Expression Region

1-438

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNTFSSVRQYLKFDLTRVVIDNIVFKLHYRWTFVILLVATLLITSRQYIGEHIQCLSDG VVSPVINTFCFFTPTFTVVRDQNQTAYRPGSEPPGIGAFDPEKDTIKRHAYYQWVPFVLF FQALCFYIPHALWKSWEGGRIKALVFGLRMVGLTRYLKNDSLRIGKLNIPSMAEAEERVK DIRRTMIDRMRLNQSWGAHLVFAEVLNLINLLLQITWTNRFLGGQFLTLGPHALKNRWSD ELSVLDLVFPKITKCKFHKFGDSGSIQMHDALCVMALNIMNEKIYIILWFWYAFLLIVTV LGLLWRILTLCFYRNVTFTRWSLYWAKPGQLDENELLAVIDKCNFSNWMFLFFLRSNLSE FLFKKVIYHLASEFPNPDHDNDVNAYREAPPTPAKNRYPELSGLDTIDSPLLHLRRNGSP SAGGAQGPSTSDMAKLPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL
BNC940342-500 1x 500 µL

CD43 (84-3C1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-100 1x 100 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-500 1x 500 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFP (Alpha Fetoprotein) (C3), CF405S conjugate, 0.1mg/mL
BNC040354-500 1x 500 µL

AFP (Alpha Fetoprotein) (C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF647 conjugate, 0.1mg/mL
BNC472289-100 1x 100 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details