Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Structural polyprotein

This Recombinant Structural polyprotein spans the amino acid sequence from region 820-1258.

Product Specifications

Product Name Alternative

Structural polyprotein, p130, Cleaved into the following 6 chains:, 1. Capsid protein, EC= 2. 3.4.21.-, Coat protein, C, p62, E3/E2

UniProt

Q80S27

Expression Region

820-1258

Origin

Middelburg virus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YEHSVTLPNAVGFPYRAHVDRPGFSPLTLHMEVVSTSLEPTLALDYVTCEYKTVVPSPKV TCCGMSECAHQQKADFQCKVYTGVYPFLWGGAYCFCDSENTQLSEAYVERSEVCKHDHAA AYRAHTAALKAKISVTYGSTNGTAEAFVNGESTARIGDLKMILGPISTAWSPFDPKIVVY KDEVYNQDYPPYGSGQPGRFGDLQSRTTESNDVYANTALKLARPSAGTVHVPYTQTPSGF KYWLKEKGDALNHKAPFGCIIKTNPVRAENCAVGNIPVSLDIPDAAFTRIVDAPSLTGLK CEVATCTHSSDFGGTLVVEYKTDKVGTCAVHSESNTAVMQETSLSVTMDGRGTLHFSTAS ASPSFVLKVCSSKTTCTAKCVPPKDHVVPFPANHNNVVFPDFSSTAVSWLTHTMGGATVV IAIGITIFLIVTCIAFSRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79b (B-Cell Marker) (B29/123), CF640R conjugate, 0.1mg/mL
BNC403107-500 1x 500 µL

CD79b (B-Cell Marker) (B29/123), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dynamin 3 (DNM3) (NM_001136127) Human Tagged ORF Clone Lentiviral Particle
RC227774L4V 200 µL

Dynamin 3 (DNM3) (NM_001136127) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PTOV1 Rabbit pAb
A16126 50 µL

PTOV1 Rabbit pAb

Sign In for Pricing
View Details
AIMP2 discontinued
305287 100 µL

AIMP2 discontinued

Sign In for Pricing
View Details
LBX2 CRISPR/Cas9 KO Plasmid (h)
sc-413788 20 µg

LBX2 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Mrpl46 3'UTR Luciferase Stable Cell Line
TU113450 1.0 mL

Mrpl46 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details