Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RING finger and transmembrane domain-containing protein 2 (Rnft2)

This Recombinant Mouse RING finger and transmembrane domain-containing protein 2 (Rnft2) spans the amino acid sequence from region 1-445.

Product Specifications

Product Name Alternative

RING finger and transmembrane domain-containing protein 2

UniProt

Q3UF64

Expression Region

1-445

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWLLAAHQVLRKMQRRHSSNTDNIPPERSRSQALSPEASVDEGGVFESLKAETASPPALF SGLAGGLPASPFPAGLVLGSTAGGGDVFIPMPATRDEAGGRSAEGSTYHHRQAHHHFHHG AHRGGSLLQHVGGDHRGHSEEGVDEQPGTPAPALSELKAVISWLQKGLPFILILLAKLCF QHKLGIAVCIGMASTFAYANSTLREQVSLKEKRSVLVILWILAFLAGNTMYVLYTFSSQQ LYSSLIFLKPNLETLDFFDLLWIVGIADFVLKYITIALKCLIVALPKIILAVKSKGKFYL VIEELSQLFRSLVPIQLWYKYIMGDDSSNSYFLGGVLIVLYSLCKSFDICGRVGGLRKAL KLLCTSQNYGVRATGQQCTEAGAVCAICQAEFRDPMILLCQHVFCEECLCLWLDRERTCP LCRSVAVDTLRCWKDGATSAHLQVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RAB5B shRNA (UAS) - Lentiviral human RAB5B shRNA (UAS, iRFP) (100)
GTR15315126 1 Vial

Lentiviral human RAB5B shRNA (UAS) - Lentiviral human RAB5B shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Mouse Marveld2 activation kit by CRISPRa
GA213553 1 Kit

Mouse Marveld2 activation kit by CRISPRa

Sign In for Pricing
View Details
Khdc4 Mouse shRNA Lentiviral Particle (Locus ID 74200)
TL504946V 500 µL Each

Khdc4 Mouse shRNA Lentiviral Particle (Locus ID 74200)

Sign In for Pricing
View Details
TM4SF19 Overexpression Lysate (Native) - (Dry Ice)
NBL1-16964 0.1 mg

TM4SF19 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
ILKAP Rabbit pAb
orb2709063-01 50 µL

ILKAP Rabbit pAb

Sign In for Pricing
View Details
ILKAP Rabbit pAb
orb2709063-02 100 µL

ILKAP Rabbit pAb

Sign In for Pricing
View Details