Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Bifunctional apoptosis regulator (BFAR)

This Recombinant Human Bifunctional apoptosis regulator (BFAR) spans the amino acid sequence from region 1-450.

Product Specifications

Product Name Alternative

Bifunctional apoptosis regulator, RING finger protein 47

UniProt

Q9NZS9

Expression Region

1-450

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLAL WWASSKKTECPECREKWEGFPKVSILLRDAIEKLFPDAIRLRFEDIQQNNDIVQSLAAFQ KYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVA KWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAIL MELERVKALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPRLSLLYLYLFDYTDTFLPFIH TICPLQEDSSGEDIVTKLLDLKEPTWKQWREFLVKYSFLPYQLIAEFAWDWLEVHYWTSR FLIINAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFVAMFWPLIPQFVCN CLFYWALYFNPIINIDLVVKELRRLETQVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ighmbp2 Rat shRNA Plasmid (Locus ID 29532)
TL711395 1 Kit

Ighmbp2 Rat shRNA Plasmid (Locus ID 29532)

Sign In for Pricing
View Details
Cpn2 ORF Vector (Rat) (pORF)
16758016 1.0 µg DNA

Cpn2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Monoclonal DFF40/CAD Antibody (36A349) [mFluor Violet 610 SE]
NB120-13592MFV610 0.1 mL

Mouse Monoclonal DFF40/CAD Antibody (36A349) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
GC, ID (GBA, GC, GLUC, Glucosylceramidase, Acid beta-glucosidase, Alglucerase, Beta-glucocerebrosidase, D-glucosyl-N-acylsphingosine glucohydrolase, Imiglucerase)
030988 100 µL

GC, ID (GBA, GC, GLUC, Glucosylceramidase, Acid beta-glucosidase, Alglucerase, Beta-glucocerebrosidase, D-glucosyl-N-acylsphingosine glucohydrolase, Imiglucerase)

Sign In for Pricing
View Details
Mcam (NM_023061) Mouse Recombinant Protein
TP509740 20 µg

Mcam (NM_023061) Mouse Recombinant Protein

Sign In for Pricing
View Details
NCOR2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV659499 1.0 µg DNA

NCOR2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details