Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Acetylcholine receptor subunit epsilon (CHRNE)

This Recombinant Human Acetylcholine receptor subunit epsilon (CHRNE) spans the amino acid sequence from region 21-493.

Product Specifications

Product Name Alternative

Acetylcholine receptor subunit epsilon

UniProt

Q04844

Expression Region

21-493

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDW QDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLVYEGGSVTWLP PAIYRSVCAVEVTYFPFDWQNCSLIFRSQTYNAEEVEFTFAVDNDGKTINKIDIDTEAYT ENGEWAIDFCPGVIRRHHGGATDGPGETDVIYSLIIRRKPLFYVINIIVPCVLISGLVLL AYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKIPETSLSVPLLGRFLIFVMVVATLIVM NCVIVLNVSQRTPTTHAMSPRLRHVLLELLPRLLGSPPPPEAPRAASPPRRASSVGLLLR AEELILKKPRSELVFEGQRHRQGTWTAAFCQSLGAAAPEVRCCVDAVNFVAESTRDQEAT GEEVSDWVRMGNALDNICFWAALVLFSVGSSLIFLGAYFNRVPDLPYAPCIQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granulin Polyclonal Antibody, Biotin Conjugated
bs-0823R-Biotin-01 20 µL

Granulin Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Granulin Polyclonal Antibody, Biotin Conjugated
bs-0823R-Biotin-02 100 µL

Granulin Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Anti-Insulin Receptor R Polyclonal Antibody
TMAB-07730-01 50 μL

Anti-Insulin Receptor R Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Insulin Receptor R Polyclonal Antibody
TMAB-07730-02 100 µL

Anti-Insulin Receptor R Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Insulin Receptor R Polyclonal Antibody
TMAB-07730-03 200 µL

Anti-Insulin Receptor R Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-VEGF receptor 2 (Tyr1059) Polyclonal Antibody, PE Conjugated
bs-3467R-PE 100 µL

Phospho-VEGF receptor 2 (Tyr1059) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details