Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yfkQ (yfkQ)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yfkQ (yfkQ) spans the amino acid sequence from region 1-513.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yfkQ

UniProt

O34486

Expression Region

1-513

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKRDKALQLIKELEDNQDRPISPNLKENLENLTLLTEGCSDIVFRQFDFGNGLCGFIVY IEGIVKSEHIQDHALRPFLMHLTDQIDEHEEALQNTLSISSVALETSMSKVAASIIEGNA VLFADGHSKGLILNIKGGQRRSIEEPITESTIRGSREGFTESLRVNTALVRFRVKTFQLK MISFKIGTKTKTDVVLAYIDGLADPKVIDKAKKRIKKIKIDAVLESGYIEEFIEDDTYSP FPQLQYTERPDTVAAQLLEGRFAIFTDNTPFVLTGPITFWQLMQASEDYYERYLMSNLIR WLRYMFLFVALYLPAIYVAVITYHQDLMPTNLMFSVASAREPIPFPAIIEALIMEISFEA LREAGVRLPKTIGQTVSILGALVIGTAAVEAGIVSAPMVIIVSLTGIASFTIPRFNLAIS IRMLRFPLMFLASIFGIFGIMLGTIILVLHLCKLQSFGIPYLSGISPFKRDEVKDIFVRA PWWTMTRRPGTYSRGNGQKGAKREDPKDEENNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL21 Human Gene Knockout Kit (CRISPR)
KN415235 1 Kit

IL21 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LIF (28-39) Goat Polyclonal Antibody
AP32068PU-N 100 µg

LIF (28-39) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Mini Sample Human PIIINP (N-Terminal Procollagen III Propeptide) ELISA Kit
E-MSEL-H0010-01 24 Tests

Mini Sample Human PIIINP (N-Terminal Procollagen III Propeptide) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Human PIIINP (N-Terminal Procollagen III Propeptide) ELISA Kit
E-MSEL-H0010-02 48 Tests

Mini Sample Human PIIINP (N-Terminal Procollagen III Propeptide) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Human PIIINP (N-Terminal Procollagen III Propeptide) ELISA Kit
E-MSEL-H0010-03 96 Tests

Mini Sample Human PIIINP (N-Terminal Procollagen III Propeptide) ELISA Kit

Sign In for Pricing
View Details
HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF405S conjugate, 0.1mg/mL
BNC042308-100 1x 100 µL

HSP27 (Heat Shock Protein 27) (rHSPB1/774), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details