Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Geobacter uraniireducens Membrane protein insertase YidC (yidC)

This Recombinant Geobacter uraniireducens Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-528.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

A5G9V4

Expression Region

1-528

Origin

Geobacter uraniireducens (strain Rf4) (Geobacter uraniumreducens)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKRVVIAVILSIAVLYAYSMIFPPPQKKDVVKPGPVPQSQTAPVQAVSSTSVLPAIMQQ GNVSVRDLVVETDLFTAVFSTRGAGLKKLVLKRYKETSGPGGREVVLVNEEAAEKFSLLT EGKSFGIEPTVVYNSISNGLKLAGNEKGTLEFTSTSPTGIVFKKSYIFTGNDYRIDLHQE LLNNSPTKFDGSLHLIGNNRIEAKPGDGRFEVYGPVTLADDKINTEKVADFSKGPKQYDK NILWTAFADKYFMNAILSDNNSIAAVRLAKVNTNYLQDDVSSPPLALNPGQSAAVNYRIF YGPKDLEILKGQGSRLEEAIDFGWFSALAKPLLRTLKFFYSYTHNYGIAIIIITVILKLL FFPLTHKSYKSMKEMQKLQPKMAELKEKFKNDRDAMNRAVMDLYKTHKVNPMGGCLPMIV QIPVFFALYKALMFSIELRHAPFMLWIMDLSAKDPYYVTPVIMGVTMFVQQKMTPSNMDP VQAKMMLALPVVFTFMFLNFPSGLVLYWLVNNILTIAQQTYINKSLPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL
BNC470977-100 1x 100 µL

TGF-beta (1D11.16.8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details