Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Membrane protein insertase YidC (yidC)

This Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Membrane protein insertase YidC (yidC) spans the amino acid sequence from region 1-532.

Product Specifications

Product Name Alternative

Membrane protein insertase YidC, Foldase YidC, Membrane integrase YidC, Membrane protein YidC

UniProt

P57131

Expression Region

1-532

Origin

Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) (Acyrthosiphon pisum symbiotic bacterium)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVQRNFFIFAFLFVSFLLWQAWQSQMFLNKKTNEKIDPIFHFIDVKKNKKKIFIKNDVI SLVVNMYGGDVEEASLLAYKDTLYSSRPFKLLETGSDFIYQAQSGLIGKDGPDSSINDSR PLYSANKNFFVLGPNEKELRVPIKWLSKNGVIYKKTFILKPNRYDVQIEYDVYNPSKESL NMNIFGQIKQTINLPKKRNVYSGNFALQTFRGAAYSSDDNKYEKYKFDMIANNKNLHIMT ESGWIAMLQQYFAVAWIPDNLGKNTIYTSSLDHDTAVIGYKSPIINIPPNSRSIIKSKLW IGPKIQKEMKLVAPNLDLTVDYGWLWFLSQPLFKLLTILYSIIGNWGFSIILITFIMRGL TYPLTKAQYISMAKMRALQPKIQEIKEKFSKDKQRISQEMILLYKKEKINPLGGFLPIFI QMPIFLSLYYMLIGSVELRHAPFLLWIHDLSSQDPYYVLPVIMGLTMFFIQKISSTNHIS DPLQKKIMNFMPVIFTAFFLWFPSGLVLYYIISNLVTIIQQKFILSNLEKNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTN4RL2 (NM_178570) Human Tagged ORF Clone Lentiviral Particle
RC217072L1V 200 µL

RTN4RL2 (NM_178570) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
WARS1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-63021R-BF350-01 20 µL

WARS1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
WARS1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-63021R-BF350-02 100 µL

WARS1 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
PLV3-U6-Prkaa2-shRNA3-CopGFP-Puro Plasmid
PVT69325 2 µg

PLV3-U6-Prkaa2-shRNA3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Glutathione S Transferase Mu 2, Muscle (GSTm2)
MBS2045619-01 0.1 mL

APC-Linked Polyclonal Antibody to Glutathione S Transferase Mu 2, Muscle (GSTm2)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Glutathione S Transferase Mu 2, Muscle (GSTm2)
MBS2045619-02 0.2 mL

APC-Linked Polyclonal Antibody to Glutathione S Transferase Mu 2, Muscle (GSTm2)

Sign In for Pricing
View Details