Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0271 (MJ0271)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0271 (MJ0271) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0271

UniProt

Q57719

Expression Region

1-180

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLKSNIKLILATDLLAVLILSLFIKNFKMVLAFLLAVFVIWLFIDKNNINERLYENLLA MSVGFIEGILIFLGIIYNEVFLDITLGIFAILILIVMGILFPKYKLIFEVFDEFVEHLKQ KSGFLTLISIFGMLLTIYVFLLILPSKEFCINAVDIIRTIMLVITANMFIIEFYTFKKFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine SELP (P-Selectin) ELISA Kit
EP0150 96 Tests

Porcine SELP (P-Selectin) ELISA Kit

Sign In for Pricing
View Details
Rad52 Rat shRNA Lentiviral Particle (Locus ID 297561)
TL705194V 500 µL Each

Rad52 Rat shRNA Lentiviral Particle (Locus ID 297561)

Sign In for Pricing
View Details
Recombinant Human UCP1 Protein, N-His
HB024012-01 50 µg

Recombinant Human UCP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human UCP1 Protein, N-His
HB024012-02 100 µg

Recombinant Human UCP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human UCP1 Protein, N-His
HB024012-03 1 mg

Recombinant Human UCP1 Protein, N-His

Sign In for Pricing
View Details
Human CNTN1 Protein Lysate 20ug
IHUCNTN1PLLY20UG 20 µg

Human CNTN1 Protein Lysate 20ug

Sign In for Pricing
View Details