Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0271 (MJ0271)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0271 (MJ0271) spans the amino acid sequence from region 1-180.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0271

UniProt

Q57719

Expression Region

1-180

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLKSNIKLILATDLLAVLILSLFIKNFKMVLAFLLAVFVIWLFIDKNNINERLYENLLA MSVGFIEGILIFLGIIYNEVFLDITLGIFAILILIVMGILFPKYKLIFEVFDEFVEHLKQ KSGFLTLISIFGMLLTIYVFLLILPSKEFCINAVDIIRTIMLVITANMFIIEFYTFKKFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX30 Rabbit Polyclonal Antibody (Cy7)
orb1062445 100 µL

SOX30 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Recombinant CD21
MBS201152-01 0.01 mg

Recombinant CD21

Sign In for Pricing
View Details
Recombinant CD21
MBS201152-02 0.02 mg

Recombinant CD21

Sign In for Pricing
View Details
Recombinant CD21
MBS201152-03 0.05 mg

Recombinant CD21

Sign In for Pricing
View Details
Recombinant CD21
MBS201152-04 0.1 mg

Recombinant CD21

Sign In for Pricing
View Details
Recombinant CD21
MBS201152-05 5x 0.01 mg

Recombinant CD21

Sign In for Pricing
View Details