Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ehrlichia canis Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Ehrlichia canis Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-191.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

Q3YT97

Expression Region

1-191

Origin

Ehrlichia canis (strain Jake)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIYTSILVLSYLIGSIPFGLILSYIGGLGDIRKIGSGNIGATNVFRKSKKLAVVTLILD SLKGFVSVMLAKNFSSDQTFVFMSALFSIIGHMFPVWLSFKGGKGVATLLGSIMFIEYKF VIYFTIFWIIVFVIFRYSSLSSIISTISIMLLVYTHYSANESITFLVMSLLVIVQHIENI VRIIKGKENKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-100 1x 100 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-100 1x 100 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), CF640R conjugate, 0.1mg/mL
BNC400637-500 1x 500 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (NF421), CF640R conjugate, 0.1mg/mL
BNC400421-100 1x 100 µL

Neurofilament (NF-H) (NF421), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF594 conjugate, 0.1mg/mL
BNC941236-500 1x 500 µL

PTH (Parathyroid Hormone) (N & C Terminal) (3H9 + PTH/1175), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details