Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Actinobacillus pleuropneumoniae serotype 5b Electron transport complex protein RnfA (rnfA)

This Recombinant Actinobacillus pleuropneumoniae serotype 5b Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A3MYN7

Expression Region

1-193

Origin

Actinobacillus pleuropneumoniae serotype 5b (strain L20)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVDYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMATTFVLTVASLSAYLVE TYVLIPLEAQFLRTLVFILVIAVIVQLTEMIVHKTSPTLYRLLGIYLPLITTNCAVLGVA LLNVNLSNNLVESVLYGFGAALGFSLVLVLFAALRERLAAADVPRPFQGASIALITAGLM SLAFMGFTGLVKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-100 1x 100 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-100 1x 100 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL
BNC880253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-500 1x 500 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-500 1x 500 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details