Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella arizonae Electron transport complex protein RnfA (rnfA)

This Recombinant Salmonella arizonae Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

A9MRW5

Expression Region

1-193

Origin

Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLDLVYLRTLSFILVIAVVVQFTEMVVRKTSPALYRLLGIFLPLITTNCAVLGVA LLNINLGHHFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNGR2 Rabbit Polyclonal Antibody
TA377355 100 µL

IFNGR2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LRRC41 (NM_006369) Human Recombinant Protein
TP310927 20 µg

LRRC41 (NM_006369) Human Recombinant Protein

Sign In for Pricing
View Details
ViPrimePLUS AtTaq qPCR Green Master Mix II, 150rxns
QLMM07 150 Reactions

ViPrimePLUS AtTaq qPCR Green Master Mix II, 150rxns

Sign In for Pricing
View Details
TNFRSF14 Rabbit Polyclonal Antibody
AP07375PU-N 50 µg

TNFRSF14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OR10H5 (C-term) Rabbit Polyclonal Antibody
AP53009PU-N 400 µL

OR10H5 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HDAC4 (C-term) Rabbit Polyclonal Antibody
AP11127PU-N 400 µL

HDAC4 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details