Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Electron transport complex protein RnfA (rnfA)

This Recombinant Escherichia coli Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

C4ZY90

Expression Region

1-193

Origin

Escherichia coli (strain K12 / MC4100 / BW2952)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLID TWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVA LLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLM SLAFMGFSGLVKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Sctr Pre-designed siRNA Set B
SI212520B 1 Each

Rat Sctr Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral human MET shRNA (UAS) - Lentiviral human MET shRNA (UAS, GFP) (100)
GTR15145617 1 Vial

Lentiviral human MET shRNA (UAS) - Lentiviral human MET shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
ELL siRNA (Mouse)
CRM1183-01 15 nmol

ELL siRNA (Mouse)

Sign In for Pricing
View Details
ELL siRNA (Mouse)
CRM1183-02 30 nmol

ELL siRNA (Mouse)

Sign In for Pricing
View Details
ITIH1 (NM_001166435) Human Tagged Lenti ORF Clone
RC230363L3 10 µg

ITIH1 (NM_001166435) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Somatostatin
550005 200 µL

Somatostatin

Sign In for Pricing
View Details