Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alkalilimnicola ehrlichei Electron transport complex protein RnfA (rnfA)

This Recombinant Alkalilimnicola ehrlichei Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-193.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA

UniProt

Q0AAG7

Expression Region

1-193

Origin

Alkalilimnicola ehrlichei (strain MLHE-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTELALILVSTVLVNNFVLVKFLGLCPFMGVSRQLETAMGMALATTFVLTLSAVCSYLAY EYLLAPLGVEYLRTITFIMVIAVVVQFTEMAVRKTSPLLHQVLGIYLPLITTNCAVLGVA LLNLQEQNSLLQSAVYGFGAAAGFSLVLVLFAALRERLEVADVPLPFRGASVALVTAGIL SMGFMGFAGLVRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF647 conjugate, 0.1mg/mL
BNC472558-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SAV1 (NM_021818) Human Over-expression Lysate
LY402881 100 µg

SAV1 (NM_021818) Human Over-expression Lysate

Sign In for Pricing
View Details
Anks1b Mouse Gene Knockout Kit (CRISPR)
KN501307 1 Kit

Anks1b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-(5-formylfuran-2-yl)benzoic Acid
TRC-F685025-50MG 50 mg

2-(5-formylfuran-2-yl)benzoic Acid

Sign In for Pricing
View Details
LRRC8C (NM_032270) Human Recombinant Protein
TP322603L 1 mg

LRRC8C (NM_032270) Human Recombinant Protein

Sign In for Pricing
View Details
Human Kallikrein 12 (KLK12) ELISA Kit
RD-KLK12-Hu-01 96 Tests

Human Kallikrein 12 (KLK12) ELISA Kit

Sign In for Pricing
View Details