Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azotobacter vinelandii Electron transport complex protein RnfA (rnfA)

This Recombinant Azotobacter vinelandii Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-194.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA, Nitrogen fixation protein RnfA

UniProt

C1DEF3

Expression Region

1-194

Origin

Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTELVLILVGAILVNNFVLVQFLGLCPFMGVSKRIETAIGLALATTFVLTLAAMCSYLLQ RYVLVPLDLEYLRTIGFILVIAVVVQFTEMLVNKTSPLLYRVLGIFLPLITTNCIVLGVA LLNANKAGYGFLESGINGFGAGLGFSLVLVLFAAMRERIAIADVPKPFKGAAIGLITAGL MSLAFMGFSGLIKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTau396 Antibody
KC-12459-01 50 μL

PTau396 Antibody

Sign In for Pricing
View Details
PTau396 Antibody
KC-12459-02 100 µL

PTau396 Antibody

Sign In for Pricing
View Details
PTau396 Antibody
KC-12459-03 1 mL

PTau396 Antibody

Sign In for Pricing
View Details
1-Bromo-4-isopropylbenzene
TRC-B696485-2.5G 2.5 g

1-Bromo-4-isopropylbenzene

Sign In for Pricing
View Details
CD68 (LAMP4/824), 0.2mg/mL
BNUB0824-500 1x 500 µL

CD68 (LAMP4/824), 0.2mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (31A3), CF405S conjugate, 0.1mg/mL
BNC040046-100 1x 100 µL

Pgp9.5 (UCHL-1) (31A3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details