Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azotobacter vinelandii Electron transport complex protein RnfA (rnfA)

This Recombinant Azotobacter vinelandii Electron transport complex protein RnfA (rnfA) spans the amino acid sequence from region 1-194.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfA, Nitrogen fixation protein RnfA

UniProt

C1DEF3

Expression Region

1-194

Origin

Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTELVLILVGAILVNNFVLVQFLGLCPFMGVSKRIETAIGLALATTFVLTLAAMCSYLLQ RYVLVPLDLEYLRTIGFILVIAVVVQFTEMLVNKTSPLLYRVLGIFLPLITTNCIVLGVA LLNANKAGYGFLESGINGFGAGLGFSLVLVLFAAMRERIAIADVPKPFKGAAIGLITAGL MSLAFMGFSGLIKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WAPL Antibody
KC-2974-01 50 μL

WAPL Antibody

Sign In for Pricing
View Details
WAPL Antibody
KC-2974-02 100 µL

WAPL Antibody

Sign In for Pricing
View Details
WAPL Antibody
KC-2974-03 1 mL

WAPL Antibody

Sign In for Pricing
View Details
Anti-HHLA3
Y058538 100 µL

Anti-HHLA3

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (NM_002273) Human Over-expression Lysate
LY419425 100 µg

Cytokeratin 8 (KRT8) (NM_002273) Human Over-expression Lysate

Sign In for Pricing
View Details
PTS (NM_000317) Human Recombinant Protein
TP305199L 1 mg

PTS (NM_000317) Human Recombinant Protein

Sign In for Pricing
View Details