Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis KinB-signaling pathway activation protein (kbaA)

This Recombinant Bacillus subtilis KinB-signaling pathway activation protein (kbaA) spans the amino acid sequence from region 1-198.

Product Specifications

Product Name Alternative

KinB-signaling pathway activation protein

UniProt

P16449

Expression Region

1-198

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSRGLVRFFFSILAVGALITSIVGFALKWGEYRGLFLTFEAGQIFSVLFWFIGVGMIFS VISQMGFFVFLTVHRFALEILRSSSLWNLLQLFFILFVAFDLMYVRFLFFGESGESLAGY AWLPVFLLIFGVITAYIKQKQSSKKTFVSSLFLMVVITALEWFPALRVNDEDWLYLMLFP LMACNAFQLLMLPKFAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HCAM Antibody
V7303SAF-100UG 100 µg

Recombinant HCAM Antibody

Sign In for Pricing
View Details
Anti-Cofilin (Phospho-S3) Antibody
CPA1625-01 30 µL

Anti-Cofilin (Phospho-S3) Antibody

Sign In for Pricing
View Details
Anti-Cofilin (Phospho-S3) Antibody
CPA1625-02 50 μL

Anti-Cofilin (Phospho-S3) Antibody

Sign In for Pricing
View Details
Anti-Cofilin (Phospho-S3) Antibody
CPA1625-03 100 µL

Anti-Cofilin (Phospho-S3) Antibody

Sign In for Pricing
View Details
Anti-Cofilin (Phospho-S3) Antibody
CPA1625-04 200 µL

Anti-Cofilin (Phospho-S3) Antibody

Sign In for Pricing
View Details
Mouse C230037L18Rik activation kit by CRISPRa
GA219607 1 Kit

Mouse C230037L18Rik activation kit by CRISPRa

Sign In for Pricing
View Details