Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfurihydrogenibium sp. ATP synthase subunit a (atpB)

This Recombinant Sulfurihydrogenibium sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-207.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B2V9G8

Expression Region

1-207

Origin

Sulfurihydrogenibium sp. (strain YO3AOP1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQHVIMALTVLIVVPVIFTIFAKKPSLIPTPIQNVFEIYIEFIDNLIKENMGEKGRKYF PLIASIGLFVFFGNLLGIIPGLESPTANLNTTMALALLVFFIYNFEGIRENGIGYFKHFL GPVPAMAPVFVIIELLSHLSRPVTLALRLFANMTGGELISVVLIMLVPFLIPMPVMLIHL IAVFLQTYVFVVLTTVYIAGAITHAEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-500 1x 500 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-500 1x 500 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
BNC880994-100 1x 100 µL

TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D205), CF640R conjugate, 0.1mg/mL
BNC400205-500 1x 500 µL

Complement C4d (C4D205), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF568 conjugate, 0.1mg/mL
BNC681706-500 1x 500 µL

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF568 conjugate, 0.1mg/mL
BNC680967-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/967), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details