Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gluconobacter oxydans Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Gluconobacter oxydans Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-210.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

Q5FRH0

Expression Region

1-210

Origin

Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGFQAQLILLSLVSYVIGSIPFGLLLTAVAGGGDIRKIGSGNIGATNVLRTGRRGLAAA TLLLDALKGALAVLIARFFFPGASETTMAVAAVAVVIGHCFPVWLGFRGGKGVATGLGTI WVLCWPVGLACCVVWLLVARLSRISSAGALAAFLLAPGLMVLLSGRPLHTPIPVATLLIS LLIWARHSSNIARLVTGREPRVKVDQASRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-100 1x 100 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF647 conjugate, 0.1mg/mL
BNC470176-100 1x 100 µL

CD5 (Cris-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-500 1x 500 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF568 conjugate, 0.1mg/mL
BNC682336-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2398), CF640R conjugate, 0.1mg/mL
BNC402398-500 1x 500 µL

SOX9 / SRY-box 9 (SOX9/2398), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF640R conjugate, 0.1mg/mL
BNC402227-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details