Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (MT-ATP6)

This Recombinant ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-212.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

O03359

Expression Region

1-212

Origin

Tropidurus montanus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PQMMGIPLILIAIILPMLLMFTSSTRLSSNRMTTMQLWVMNTITKQLFLPVNMPGHKWAA MLITLMIFLLSMNMLGLLPYTFTPTTQLSMNMALAAPLWLATVLTGLRNQPTASLGHLLP EGTPTPLIPLLIIIETVSLFIRPLALGVRLTANLTAGHLLIQLISTAAFVLMPTMPMAAL STLIVLMLLTGLEIAVAMIQAYVFTLLLTLYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC5AC (Mucin 5AC / Gastric Mucin) (rMUC5AC/3779), CF568 conjugate, 0.1mg/mL
BNC683779-500 1x 500 µL

MUC5AC (Mucin 5AC / Gastric Mucin) (rMUC5AC/3779), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS646408 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
2-Deoxy-D-ribose
TRC-D252000-1G 1 g

2-Deoxy-D-ribose

Sign In for Pricing
View Details
C10orf30 (BEND7) Human Gene Knockout Kit (CRISPR)
KN415807 1 Kit

C10orf30 (BEND7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS716544 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
ZCCHC9 (NM_001131035) Human Over-expression Lysate
LY427368 100 µg

ZCCHC9 (NM_001131035) Human Over-expression Lysate

Sign In for Pricing
View Details