Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (MT-ATP6)

This Recombinant ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-212.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

O03359

Expression Region

1-212

Origin

Tropidurus montanus

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

PQMMGIPLILIAIILPMLLMFTSSTRLSSNRMTTMQLWVMNTITKQLFLPVNMPGHKWAA MLITLMIFLLSMNMLGLLPYTFTPTTQLSMNMALAAPLWLATVLTGLRNQPTASLGHLLP EGTPTPLIPLLIIIETVSLFIRPLALGVRLTANLTAGHLLIQLISTAAFVLMPTMPMAAL STLIVLMLLTGLEIAVAMIQAYVFTLLLTLYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4'-Bromovalerophenone
TRC-B689025-5G 5 g

4'-Bromovalerophenone

Sign In for Pricing
View Details
KCNIP4 Human qPCR Primer Pair (NM_025221)
HP232122 200 Reactions

KCNIP4 Human qPCR Primer Pair (NM_025221)

Sign In for Pricing
View Details
Human RMND5A activation kit by CRISPRa
GA112154 1 Kit

Human RMND5A activation kit by CRISPRa

Sign In for Pricing
View Details
B3GAT1 Polyclonal Antibody
E-AB-13132-01 20 µL

B3GAT1 Polyclonal Antibody

Sign In for Pricing
View Details
B3GAT1 Polyclonal Antibody
E-AB-13132-02 60 µL

B3GAT1 Polyclonal Antibody

Sign In for Pricing
View Details
B3GAT1 Polyclonal Antibody
E-AB-13132-03 120 µL

B3GAT1 Polyclonal Antibody

Sign In for Pricing
View Details