Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Albinaria coerulea ATP synthase subunit a (ATP6)

This Recombinant Albinaria coerulea ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-214.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P48893

Expression Region

1-214

Origin

Albinaria coerulea (Land snail)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMVDLFSSLDGMTSLWSWLTPMFLSVFMIWNKTWSMDQNNIIKYLAASNWNNSTYNLTKS LLTIMMVLIIFNNLLGMAPFTYGITTSLWVNMTLALLLWGLILLSGYIKSPKKSLAHLAP SGAPLLLLPFLILIESISIMIRPLTLTVRLVANMSAGHIILALMASVLSSNLSNTSLSLS YLIMVGYYLFEFFVCFIQAYIFTLLLSLYMNEHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-500 1x 500 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL
BNC880978-100 1x 100 µL

CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF640R conjugate, 0.1mg/mL
BNC402329-100 1x 100 µL

MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF640R conjugate, 0.1mg/mL
BNC402984-100 1x 100 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details