Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heme exporter protein B (ccmB)

This Recombinant Heme exporter protein B (ccmB) spans the amino acid sequence from region 1-220.

Product Specifications

Product Name Alternative

Heme exporter protein B, Cytochrome c-type biogenesis protein CcmB

UniProt

P0ABM0

Expression Region

1-220

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMFWRIFRLELRVAFRHSAEIANPLWFFLIVITLFPLSIGPEPQLLARIAPGIIWVAALL SSLLALERLFRDDLQDGSLEQLMLLPLPLPAVVLAKVMAHWMVTGLPLLILSPLVAMLLG MDVYGWQVMALTLLLGTPTLGFLGAPGVALTVGLKRGGVLLSILVLPLTIPLLIFATAAM DAASMHLPVDGYLAILGALLAGTATLSPFATAAALRISIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPF2 (NM_080599) Human Tagged Lenti ORF Clone
RC215944L3 10 µg

UPF2 (NM_080599) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0745 protein PA1295 (PA1295)
MBS1335337-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa UPF0745 protein PA1295 (PA1295)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0745 protein PA1295 (PA1295)
MBS1335337-02 0.1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa UPF0745 protein PA1295 (PA1295)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0745 protein PA1295 (PA1295)
MBS1335337-03 0.02 mg (Yeast)

Recombinant Pseudomonas aeruginosa UPF0745 protein PA1295 (PA1295)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0745 protein PA1295 (PA1295)
MBS1335337-04 0.1 mg (Yeast)

Recombinant Pseudomonas aeruginosa UPF0745 protein PA1295 (PA1295)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa UPF0745 protein PA1295 (PA1295)
MBS1335337-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas aeruginosa UPF0745 protein PA1295 (PA1295)

Sign In for Pricing
View Details