Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0056 inner membrane protein marC (marC)

This Recombinant UPF0056 inner membrane protein marC (marC) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

UPF0056 inner membrane protein marC

UniProt

P0A2L6

Expression Region

1-221

Origin

Salmonella typhi

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSYMASVYVFAIMMVAYY AGQLVMNTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAHESPEAKSKSEELADEPTANIA FVPLAMPSTAGPGTIAMIISSASTVRHGGEFPDWVIMVAPPIIFLAVAVILWGCLRSSGA IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGVLEIIKTYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2S)-2-Amino-3-[2,3-dihydroxypropoxy(hydroxy)phosphoryl]oxypropanoic Acid Sodium salt
TRC-A780290-5MG 5 mg

(2S)-2-Amino-3-[2,3-dihydroxypropoxy(hydroxy)phosphoryl]oxypropanoic Acid Sodium salt

Sign In for Pricing
View Details
NQO1 Mouse Monoclonal Antibody [Clone ID: 4D12]
AM06702SU-N 100 µL

NQO1 Mouse Monoclonal Antibody [Clone ID: 4D12]

Sign In for Pricing
View Details
Chk2 (CHEK2) Human Gene Knockout Kit (CRISPR)
KN201278 1 Kit

Chk2 (CHEK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZDBF2 Human Gene Knockout Kit (CRISPR)
KN419202 1 Kit

ZDBF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Haze Meter BMET-1202
BMET-1202 1 Unit

Haze Meter BMET-1202

Sign In for Pricing
View Details
3-Fluoropropan-1-ol
TRC-F598605-25G 25 g

3-Fluoropropan-1-ol

Sign In for Pricing
View Details