Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Transmembrane protein 147 (tmem147)

This Recombinant Xenopus laevis Transmembrane protein 147 (tmem147) spans the amino acid sequence from region 1-225.

Product Specifications

Product Name Alternative

Transmembrane protein 147

UniProt

Q6DFI2

Expression Region

1-225

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWRCVQAGATYLCVQLCKMLFLATFFPTW EGAAGAYDFIGEFMKATVDLADLLGLHLVMSRNAGKGEYKIMVAAMGWATAELVMSRCLP LWVGARGIEFDWKYIQMSIDSNISLVHYMAVAALVWMWTRYDLPTHYRLPVTVLLGLSMY KAFLMDCFVHMFIMGSWTALLLKAVITGVLSLSCLTLFVSLVHGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-500 1x 500 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-100 1x 100 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-500 1x 500 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC040525-500 1x 500 µL

CD63 (MX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-100 1x 100 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details