Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella dublin Electron transport complex protein RnfE (rnfE)

This Recombinant Salmonella dublin Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B5FIF0

Expression Region

1-230

Origin

Salmonella dublin (strain CT_02021853)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLARLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRP1 Antibody
MBS9417952-01 0.05 mL

SFRP1 Antibody

Sign In for Pricing
View Details
SFRP1 Antibody
MBS9417952-02 0.1 mL

SFRP1 Antibody

Sign In for Pricing
View Details
SFRP1 Antibody
MBS9417952-03 5x 0.1 mL

SFRP1 Antibody

Sign In for Pricing
View Details
FAM92B Human shRNA Plasmid Kit (Locus ID 339145)
TL304592 1 Kit

FAM92B Human shRNA Plasmid Kit (Locus ID 339145)

Sign In for Pricing
View Details
CTPS 3'UTR Luciferase Stable Cell Line
TU005234 1.0 mL

CTPS 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CARS Rabbit Polyclonal Antibody (HRP)
orb2125916 100 µL

CARS Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details