Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella dublin Electron transport complex protein RnfE (rnfE)

This Recombinant Salmonella dublin Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B5FIF0

Expression Region

1-230

Origin

Salmonella dublin (strain CT_02021853)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDIVVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTVSALR RWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPWLSALDGFSIGMGATGAMFVLGSLREILGNGTLFDGADSLLGGWAKVLRVEIFHTD SPFLLARLPPGAFIGLGLMLAVKYLIDEKMKKRRAETAPSAVPAGETGKV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBiFC-CMV-HA-DTX2-VC155 Plasmid
PVT73623 2 µg

PBiFC-CMV-HA-DTX2-VC155 Plasmid

Sign In for Pricing
View Details
Liquid reagents for total chlorine 0.00-5.00 mg/l (±300 tests)
HI93702-01 1 Each

Liquid reagents for total chlorine 0.00-5.00 mg/l (±300 tests)

Sign In for Pricing
View Details
DCXR Human shRNA Lentiviral Particle (Locus ID 51181)
TL305077V 500 µL Each

DCXR Human shRNA Lentiviral Particle (Locus ID 51181)

Sign In for Pricing
View Details
MSRA antibody - middle region (ARP56732_P050)
ARP56732_P050 100 µL

MSRA antibody - middle region (ARP56732_P050)

Sign In for Pricing
View Details
Recombinant Human NRG4
RPF11562-01 50 µg

Recombinant Human NRG4

Sign In for Pricing
View Details
Recombinant Human NRG4
RPF11562-02 200 µg

Recombinant Human NRG4

Sign In for Pricing
View Details