Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Electron transport complex protein RnfE (rnfE)

This Recombinant Escherichia coli Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

B6IB70

Expression Region

1-231

Origin

Escherichia coli (strain SE11)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEIKDVIVQGLWKNNSALVQLLGLCPLLAVTSTATNALGLGLATTLVLTLTNLTISTLR HWTPAEIRIPIYVMIIASVVSAVQMLINAYAFGLYQSLGIFIPLIVTNCIVVGRAEAFAA KKGPALSALDGFSIGMGATCAMFVLGSLREIIGNGTLFDGADALLGSWAKVLRVEIFHTD SPFLLAMLPPGAFIGLGLMLAGKYLIDERMKKRRAEATAERALPNGETGNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Green Fluorescence Optimized for Microplate Readers*
22791-AAT 100 Tests

Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Green Fluorescence Optimized for Microplate Readers*

Sign In for Pricing
View Details
1-Oleoyl-2-acetyl-sn-glycerol
TRC-O526000-25MG 25 mg

1-Oleoyl-2-acetyl-sn-glycerol

Sign In for Pricing
View Details
CD4 Recombinant Rabbit monoclonal Antibody [ST0488]
ET1609-52-50UL 50 µL

CD4 Recombinant Rabbit monoclonal Antibody [ST0488]

Sign In for Pricing
View Details
9-Oxononanoic Acid
TRC-O858160-50MG 50 mg

9-Oxononanoic Acid

Sign In for Pricing
View Details
Cebpe Mouse Gene Knockout Kit (CRISPR)
KN503102 1 Kit

Cebpe Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GLI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A8]
TA803968BM 100 µL

GLI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A8]

Sign In for Pricing
View Details