Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pestis bv. Antiqua Electron transport complex protein RnfE (rnfE)

This Recombinant Yersinia pestis bv. Antiqua Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

Q1CIZ3

Expression Region

1-233

Origin

Yersinia pestis bv. Antiqua (strain Nepal516)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEAKNLLAQGLWKNNSALVQLLGLCPLLAVSSTATNALGLGLATTLVLVCTNTAVSALR RWVPSEIRIPIYVMIIASVVSTVQMLINAYAFGLYQSLGIFIPLIVTNCIVIGRAEAYAA KNPVGLSALDGFAMGMGATCALFVLGALREILGNGTLFDGADMLLGSWATVLRIDILHLD TPFLLAMLPPGAFIGLGLLLAGKYVIDEKMKARKANTRVSVPQLQDGDAEKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL
BNC880218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
BNC880040-500 1x 500 µL

CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-100 1x 100 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL
BNC400745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details