Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus tropicalis DNA damage-regulated autophagy modulator protein 1 (dram1)

This Recombinant Xenopus tropicalis DNA damage-regulated autophagy modulator protein 1 (dram1) spans the amino acid sequence from region 1-239.

Product Specifications

Product Name Alternative

DNA damage-regulated autophagy modulator protein 1, Damage-regulated autophagy modulator

UniProt

Q5EAK8

Expression Region

1-239

Origin

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPCWCLHGAAFLPSILVIWSSAGFLFSYIISVLIGHVPPFVPYISDTGTSPPESGVFGFM ISLSAMLGAATMYTRYKILEKQNHSTDFLPYYFNKTSLAIGLLGCIGMGIVATFQEMAVP AVHDAGALITFICGVLYILLQSYISYKSCPAWNTRVTCHIRMAISVIAFIAVVPMSVFSV LSGRKRLDWKPSDEGYHYHLTSAICEWIVAFGFNMYFLTFIRDFQGVSIQISTEIHEDF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL
BNC401231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL
BNC680391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-100 1x 100 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 (DOG1.1), CF405S conjugate, 0.1mg/mL
BNC040725-100 1x 100 µL

DOG-1 (DOG1.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1469), CF405S conjugate, 0.1mg/mL
BNC041469-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/1469), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details