Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alkaliphilus oremlandii Cobalamin synthase (cobS)

This Recombinant Alkaliphilus oremlandii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A8MIW2

Expression Region

1-243

Origin

Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSLLLMMTFFTRIPVTYPYDYDEKDFIKGVKFLPVIGLLIGILMYLPTLLAPYIHRPII IVSIWALYFLITGGLHIDGLADTFDGIFSYRSKEEMLRIMKDSRIGAFGVLGILWLLILN LTLAYYTENMLLLLVPVVGRASAVFAASRTIYARSEGMGGAFIESCRTKEGVISIAFSLL LGSMVSIKGAIIPMGITFLGVAMLTKKISKILGGMTGDTIGATIEISQTLFMLSAYLLKS III

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human VNN3 Protein - (Dry Ice)
H00055350-Q01-25ug 25 µg

Recombinant Human VNN3 Protein - (Dry Ice)

Sign In for Pricing
View Details
Human MDH1 Protein Lysate 20ug
IHUMDH1PLLY20UG 20 µg

Human MDH1 Protein Lysate 20ug

Sign In for Pricing
View Details
Chicken Zona pellucida sperm-binding protein 3 ELISA Kit
MBS289239-01 48 Well

Chicken Zona pellucida sperm-binding protein 3 ELISA Kit

Sign In for Pricing
View Details
Chicken Zona pellucida sperm-binding protein 3 ELISA Kit
MBS289239-02 96 Well

Chicken Zona pellucida sperm-binding protein 3 ELISA Kit

Sign In for Pricing
View Details
Chicken Zona pellucida sperm-binding protein 3 ELISA Kit
MBS289239-03 5x 96 Well

Chicken Zona pellucida sperm-binding protein 3 ELISA Kit

Sign In for Pricing
View Details
Chicken Zona pellucida sperm-binding protein 3 ELISA Kit
MBS289239-04 10x 96 Well

Chicken Zona pellucida sperm-binding protein 3 ELISA Kit

Sign In for Pricing
View Details