Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alkaliphilus oremlandii Cobalamin synthase (cobS)

This Recombinant Alkaliphilus oremlandii Cobalamin synthase (cobS) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A8MIW2

Expression Region

1-243

Origin

Alkaliphilus oremlandii (strain OhILAs) (Clostridium oremlandii (strain OhILAs) )

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSLLLMMTFFTRIPVTYPYDYDEKDFIKGVKFLPVIGLLIGILMYLPTLLAPYIHRPII IVSIWALYFLITGGLHIDGLADTFDGIFSYRSKEEMLRIMKDSRIGAFGVLGILWLLILN LTLAYYTENMLLLLVPVVGRASAVFAASRTIYARSEGMGGAFIESCRTKEGVISIAFSLL LGSMVSIKGAIIPMGITFLGVAMLTKKISKILGGMTGDTIGATIEISQTLFMLSAYLLKS III

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAF1 Rabbit pAb, AP conjugated
orb2885738 100 µL

NAF1 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Diisopropyl hydrogen phosphate
OR1071701-01 50 mg

Diisopropyl hydrogen phosphate

Sign In for Pricing
View Details
Diisopropyl hydrogen phosphate
OR1071701-02 100 mg

Diisopropyl hydrogen phosphate

Sign In for Pricing
View Details
Diisopropyl hydrogen phosphate
OR1071701-03 250 mg

Diisopropyl hydrogen phosphate

Sign In for Pricing
View Details
Diisopropyl hydrogen phosphate
OR1071701-04 1 g

Diisopropyl hydrogen phosphate

Sign In for Pricing
View Details
Casein Kinase 2 Substrate Peptide, RRRDDDSDDD (CK2)
MBS659520-01 1 µmol

Casein Kinase 2 Substrate Peptide, RRRDDDSDDD (CK2)

Sign In for Pricing
View Details