Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pelagibacter ubique ATP synthase subunit a (atpB)

This Recombinant Pelagibacter ubique ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-244.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q4FPE9

Expression Region

1-244

Origin

Pelagibacter ubique (strain HTCC1062)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATNPMNQFEVYRIGPEIKLGAIDISFTNASLFMVISSLAILLIFNLGSKKNSLLPSKMQ LLSELSYTFVSKMISDTAGSKAKPYFAFIFSIFMFVLFCNMFGMIPYAFTVTSHIIVTFI LASFIFVGVTIIGFMKHGLGYLKLFVPSGVPAVLLPLIVVIEIISYLSRPVSLSVRLFAN MMAGHTMMKVFGGFVISLGIVGGWLPLSFSVALTGLEILVAFLQAYVFAILTCIYLNDAL NLHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-500 1x 500 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF740 conjugate, 0.1mg/mL
BNC742210-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (BCL2/2210R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF594 conjugate, 0.1mg/mL
BNC942419-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF405S conjugate, 0.1mg/mL
BNC041531-500 1x 500 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details