Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella schwarzengrund Cobalamin synthase (cobS)

This Recombinant Salmonella schwarzengrund Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B4TZP6

Expression Region

1-247

Origin

Salmonella schwarzengrund (strain CVM19633)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQSWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYHHRYARDEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTLAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKAP2 Antibody (Center)
E45M08685G-4 50 µL

SKAP2 Antibody (Center)

Sign In for Pricing
View Details
Rabbit Polyclonal ITIH3 Antibody [PE]
NBP2-97601PE 0.1 mL

Rabbit Polyclonal ITIH3 Antibody [PE]

Sign In for Pricing
View Details
FAM41BY sgRNA CRISPR Lentivector set (Human)
K0722301 3x 1.0 µg

FAM41BY sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
GPR151 Adenovirus (Mouse)
22518054 1.0 mL

GPR151 Adenovirus (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Haao shRNA (UAS) - Lentiviral mouse Haao shRNA (UAS, iRFP) (25)
GTR15206090 1 Vial

Lentiviral mouse Haao shRNA (UAS) - Lentiviral mouse Haao shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
POLR3E Antibody - middle region
OASG06010-100UL 100 µL

POLR3E Antibody - middle region

Sign In for Pricing
View Details