Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella schwarzengrund Cobalamin synthase (cobS)

This Recombinant Salmonella schwarzengrund Cobalamin synthase (cobS) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B4TZP6

Expression Region

1-247

Origin

Salmonella schwarzengrund (strain CVM19633)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKLFWAMLAFISRLPVPSRWSQGLDFEQYSRGIVMFPFIGLILGGVSGLIFILLQSWCG IPLAALFCILALALLTGGFHLDGLADTCDGIFSARRRERMLEIMRDSRLGTHGGLALIFV LLAKILVVSELALRGTPMLAALAAACAAGRGSAVLLMYHHRYARDEGLGNVFIGKVSGRQ TCITLGLAVIVATVLLPGMQGLAAMVVTLAAIFILGQLLKRTLGGQTGDTLGAAIELGEL IFLLALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TOLLIP Protein, His (Fc)-Avi-tagged
TOLLIP-2231H 50 µg

Recombinant Human TOLLIP Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Bovine Cardiac Troponin T autoantibody ELISA Kit
MBS7280943-01 48 Well

Bovine Cardiac Troponin T autoantibody ELISA Kit

Sign In for Pricing
View Details
Bovine Cardiac Troponin T autoantibody ELISA Kit
MBS7280943-02 96 Well

Bovine Cardiac Troponin T autoantibody ELISA Kit

Sign In for Pricing
View Details
Bovine Cardiac Troponin T autoantibody ELISA Kit
MBS7280943-03 5x 96 Well

Bovine Cardiac Troponin T autoantibody ELISA Kit

Sign In for Pricing
View Details
Bovine Cardiac Troponin T autoantibody ELISA Kit
MBS7280943-04 10x 96 Well

Bovine Cardiac Troponin T autoantibody ELISA Kit

Sign In for Pricing
View Details
RWDD4P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV747668 1.0 µg DNA

RWDD4P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details