Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0259 membrane protein BUsg_265 (BUsg_265)

This Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0259 membrane protein BUsg_265 (BUsg_265) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

UPF0259 membrane protein BUsg_265

UniProt

P42396

Expression Region

1-247

Origin

Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSITIRELCNDTYHFVSKEIKIIIFISVLAAFISILINVLIKPNIHIISIIENKKFLSSH SIFDLINSMSIYEKKELLKYSIFKIFEFLISKTFLLGSIITLITHLSNHKKESIQFSLNS LCKFLPSLFILNFITTFFIQIGFMFFIFPGIFLSVLLALSPIILSFKKNNLIDCIRLSIS ISCKHLNIVGTSVLFWMCVKFILTTVFSNTYIISKNFIFLILNINMNIFFSILIVYLFRF YMLFLRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-100 1x 100 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-100 1x 100 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-500 1x 500 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), CF594 conjugate, 0.1mg/mL
BNC941537-500 1x 500 µL

Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (NCL/902), CF640R conjugate, 0.1mg/mL
BNC400902-100 1x 100 µL

Nucleolin (NCL/902), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details