Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium botulinum Cobalamin synthase (cobS)

This Recombinant Clostridium botulinum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

B1KX15

Expression Region

1-248

Origin

Clostridium botulinum (strain Loch Maree / Type A3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSILNDFLLMIQFFTRIPINKNLQCEKANFRRGAFFLPVVASIIGGMEFLIYLGLKNFL PSNVIIVLLLLFTAMITGGLHMDGLADTCDGFFSLRDKERIIEIMKDSRIGSYGTIALII DLLLKYQLLYSLVLKGYSIAIFLAPIIGRISILFLCLSKRTAKKNGSGNIFIGNMSKPIV FFISTIVLVLSTYFLGLRATIIPFIGALLITYLLYLLCLNKINGLTGDTLGACNELGEIT FLLILLMM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDAP1L1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G5]
TA503153BM 100 µL

GDAP1L1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G5]

Sign In for Pricing
View Details
GOT2 Mouse Monoclonal Antibody [Clone ID: 3E9]
AM06383SU-N 100 µL

GOT2 Mouse Monoclonal Antibody [Clone ID: 3E9]

Sign In for Pricing
View Details
Human SVEP1 activation kit by CRISPRa
GA112773 1 Kit

Human SVEP1 activation kit by CRISPRa

Sign In for Pricing
View Details
ZPBP Polyclonal Antibody
E-AB-18474-01 20 µL

ZPBP Polyclonal Antibody

Sign In for Pricing
View Details
ZPBP Polyclonal Antibody
E-AB-18474-02 60 µL

ZPBP Polyclonal Antibody

Sign In for Pricing
View Details
ZPBP Polyclonal Antibody
E-AB-18474-03 120 µL

ZPBP Polyclonal Antibody

Sign In for Pricing
View Details