Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Paracoccus denitrificans ATP synthase subunit a (atpB)

This Recombinant Paracoccus denitrificans ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1B619

Expression Region

1-248

Origin

Paracoccus denitrificans (strain Pd 1222)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEEEAGGLVFHPMDQFVIKPLFGEGPVNWYTPTNATLWMALAALAITALLVFGTRGRAI VPNRVQSIAELLYGMVHKMVEDVTGKDGLKYFPYVMTLFCFILFANFLGLLPKSFSPTSH IAVTAVLAVLVFAGVTVLGFVKNGAHFLGLFWVSSAPLALRPVLAVIELISYFVRPVSHS IRLAGNIMAGHAVIKVFAAFAAVAAIAPVSVVAITAMYGLEVLVCLIQAYVFTILTCVYL KDALHPAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM4SF19 (NM_138461) Human Recombinant Protein
TP322675M 100 µg

TM4SF19 (NM_138461) Human Recombinant Protein

Sign In for Pricing
View Details
Ftl1 (NM_010240) Mouse Recombinant Protein
TP501658 20 µg

Ftl1 (NM_010240) Mouse Recombinant Protein

Sign In for Pricing
View Details
FCGR2B Antibody
KC-3912-01 50 μL

FCGR2B Antibody

Sign In for Pricing
View Details
FCGR2B Antibody
KC-3912-02 100 µL

FCGR2B Antibody

Sign In for Pricing
View Details
FCGR2B Antibody
KC-3912-03 1 mL

FCGR2B Antibody

Sign In for Pricing
View Details
NXPE2 (NM_182495) Human Over-expression Lysate
LY430590 100 µg

NXPE2 (NM_182495) Human Over-expression Lysate

Sign In for Pricing
View Details