Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Paracoccus denitrificans ATP synthase subunit a (atpB)

This Recombinant Paracoccus denitrificans ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-248.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A1B619

Expression Region

1-248

Origin

Paracoccus denitrificans (strain Pd 1222)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEEEAGGLVFHPMDQFVIKPLFGEGPVNWYTPTNATLWMALAALAITALLVFGTRGRAI VPNRVQSIAELLYGMVHKMVEDVTGKDGLKYFPYVMTLFCFILFANFLGLLPKSFSPTSH IAVTAVLAVLVFAGVTVLGFVKNGAHFLGLFWVSSAPLALRPVLAVIELISYFVRPVSHS IRLAGNIMAGHAVIKVFAAFAAVAAIAPVSVVAITAMYGLEVLVCLIQAYVFTILTCVYL KDALHPAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFC Antibody
8C10895-AAT 50 µg

TNFC Antibody

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF594 conjugate, 0.1mg/mL
BNC941981-500 1x 500 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OR8H2 Antibody
8G688-AAT 50 µg

OR8H2 Antibody

Sign In for Pricing
View Details
CD27 Recombinant Rabbit Monoclonal Antibody [JB40-98]
ET7107-73 100 µL

CD27 Recombinant Rabbit Monoclonal Antibody [JB40-98]

Sign In for Pricing
View Details
BLNK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B2]
TA808522BM 100 µL

BLNK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B2]

Sign In for Pricing
View Details
Ethyl Acetate
TRC-E678350-500ML 500 mL

Ethyl Acetate

Sign In for Pricing
View Details