Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis PQ-loop repeat-containing protein 1 (pqlc1)

This Recombinant Xenopus laevis PQ-loop repeat-containing protein 1 (pqlc1) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 1

UniProt

Q6NRS2

Expression Region

1-250

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEREGLEWIVAFLRMLVSWGASCAMIFGGVVPYIPQYRDIRRTQNAEGFSIYVCLMLLIA NILRILFWFGHHFESPLLWQSIIMIVTMLLMLKLCTEVRVANELNPKRRSFTDFDTAFFW HWTRFIDFIQCVLAFTGVTGYITYLLLDSPLFVEILGFLAVFTEALLGVPQLYRNHQNYS TEGMSIKMVLMWTSGDTFKSAYFVLNQAPFQFSICGLLQVFVDIAILLQVYLYSAYPQKP VSHATSAKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRP5 (ABCC5) Human Gene Knockout Kit (CRISPR)
KN217669 1 Kit

MRP5 (ABCC5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glycyl-L-Tyrosine Dihydrate
TRC-G765040-2.5G 2.5 g

Glycyl-L-Tyrosine Dihydrate

Sign In for Pricing
View Details
CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF594 conjugate, 0.1mg/mL
BNC940201-100 1x 100 µL

CD2 / Lymphocyte Function Antigen 2 (LFA-2) (UMCD2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Phospho-p53 (S20) Recombinant Rabbit Monoclonal Antibody [PSH06-86]
HA722761 100 µL

Phospho-p53 (S20) Recombinant Rabbit Monoclonal Antibody [PSH06-86]

Sign In for Pricing
View Details
n-Propyltriphenylphosphonium Bromide
TRC-P838390-50G 50 g

n-Propyltriphenylphosphonium Bromide

Sign In for Pricing
View Details
Vmn2r71 Mouse Gene Knockout Kit (CRISPR)
KN519202 1 Kit

Vmn2r71 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details