Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis PQ-loop repeat-containing protein 1 (pqlc1)

This Recombinant Xenopus laevis PQ-loop repeat-containing protein 1 (pqlc1) spans the amino acid sequence from region 1-250.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 1

UniProt

Q6NRS2

Expression Region

1-250

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEREGLEWIVAFLRMLVSWGASCAMIFGGVVPYIPQYRDIRRTQNAEGFSIYVCLMLLIA NILRILFWFGHHFESPLLWQSIIMIVTMLLMLKLCTEVRVANELNPKRRSFTDFDTAFFW HWTRFIDFIQCVLAFTGVTGYITYLLLDSPLFVEILGFLAVFTEALLGVPQLYRNHQNYS TEGMSIKMVLMWTSGDTFKSAYFVLNQAPFQFSICGLLQVFVDIAILLQVYLYSAYPQKP VSHATSAKAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLT1B Human Gene Knockout Kit (CRISPR)
KN401871 1 Kit

GOLT1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Aldosterone ELISA Kit
K052-H5 5 Plates

Aldosterone ELISA Kit

Sign In for Pricing
View Details
Human Histone H3.3C (H3F3C) activation kit by CRISPRa
GA118436 1 Kit

Human Histone H3.3C (H3F3C) activation kit by CRISPRa

Sign In for Pricing
View Details
CTAG1A Antibody
KC-3790-01 50 μL

CTAG1A Antibody

Sign In for Pricing
View Details
CTAG1A Antibody
KC-3790-02 100 µL

CTAG1A Antibody

Sign In for Pricing
View Details
CTAG1A Antibody
KC-3790-03 1 mL

CTAG1A Antibody

Sign In for Pricing
View Details