Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium perfringens Cobalamin synthase (cobS)

This Recombinant Clostridium perfringens Cobalamin synthase (cobS) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q0STX5

Expression Region

1-251

Origin

Clostridium perfringens (strain SM101 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIFYKAINMTLSMFTVIPLPKYEWDDRAAKHIMKLYPFIGLIIGILWYLSFFVLSKLNV PIMLMAALILTVPYILTGFLHLDGFMDVSDALLSRRDKETKLRILKDSTVGAFSVISVVL LLLVEFAGIFTVLNKNLDMRILIFIPIASRTMNGYFIVSQEMLGQSSLAKFFKEGTGKVD EIILLGIYVLVALITFFTLGINYLIAILAMGLISFILLLKVKKELGGINGDVAGYILVLM EFTGILLLGII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken ATM Interactor (ATMIN) ELISA Kit
MBS9389101 Inquire

Chicken ATM Interactor (ATMIN) ELISA Kit

Sign In for Pricing
View Details
NKX1-2 Protein Lysate (Rat) with C-HA Tag
31877036 100 µg

NKX1-2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
S27A1 rabbit pAb
E28PT7179 100 µL

S27A1 rabbit pAb

Sign In for Pricing
View Details
UBXD5 Lentiviral Activation Particles (h)
sc-413899-LAC 200 µL

UBXD5 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Etigilimab (TIGIT/VSTM3) - Research Grade Biosimilar Antibody
orb1237695 0.1 mg

Etigilimab (TIGIT/VSTM3) - Research Grade Biosimilar Antibody

Sign In for Pricing
View Details
Goat Alpha-1, 6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A (MGAT5) ELISA Kit
MBS7235031-01 48 Well

Goat Alpha-1, 6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A (MGAT5) ELISA Kit

Sign In for Pricing
View Details