Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium perfringens Cobalamin synthase (cobS)

This Recombinant Clostridium perfringens Cobalamin synthase (cobS) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q0STX5

Expression Region

1-251

Origin

Clostridium perfringens (strain SM101 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIFYKAINMTLSMFTVIPLPKYEWDDRAAKHIMKLYPFIGLIIGILWYLSFFVLSKLNV PIMLMAALILTVPYILTGFLHLDGFMDVSDALLSRRDKETKLRILKDSTVGAFSVISVVL LLLVEFAGIFTVLNKNLDMRILIFIPIASRTMNGYFIVSQEMLGQSSLAKFFKEGTGKVD EIILLGIYVLVALITFFTLGINYLIAILAMGLISFILLLKVKKELGGINGDVAGYILVLM EFTGILLLGII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPMI-1640, with L-alanyl-L-glutamine, without phenol red
PM150118 500 mL

RPMI-1640, with L-alanyl-L-glutamine, without phenol red

Sign In for Pricing
View Details
FAM65B CRISPR/Cas9 KO Plasmid (m)
sc-431444 20 µg

FAM65B CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
α-Carboline-15N2 N-Oxide
sc-220428 1 mg

α-Carboline-15N2 N-Oxide

Sign In for Pricing
View Details
Mouse Folr2 Pre-designed siRNA Set B
SI105029B 1 Each

Mouse Folr2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
cyclin G2 CRISPR/Cas9 KO Plasmid (m)
sc-419516 20 µg

cyclin G2 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Lentiviral mouse Supt6 shRNA (UAS) - Lentiviral mouse Supt6 shRNA (UAS, RFP) plasmid
GTR15219553 1 Vial

Lentiviral mouse Supt6 shRNA (UAS) - Lentiviral mouse Supt6 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details