Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium perfringens Cobalamin synthase (cobS)

This Recombinant Clostridium perfringens Cobalamin synthase (cobS) spans the amino acid sequence from region 1-251.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q0STX5

Expression Region

1-251

Origin

Clostridium perfringens (strain SM101 / Type A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIFYKAINMTLSMFTVIPLPKYEWDDRAAKHIMKLYPFIGLIIGILWYLSFFVLSKLNV PIMLMAALILTVPYILTGFLHLDGFMDVSDALLSRRDKETKLRILKDSTVGAFSVISVVL LLLVEFAGIFTVLNKNLDMRILIFIPIASRTMNGYFIVSQEMLGQSSLAKFFKEGTGKVD EIILLGIYVLVALITFFTLGINYLIAILAMGLISFILLLKVKKELGGINGDVAGYILVLM EFTGILLLGII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sccpdh Mouse siRNA Oligo Duplex (Locus ID 109232)
SR414184 1 Kit

Sccpdh Mouse siRNA Oligo Duplex (Locus ID 109232)

Sign In for Pricing
View Details
CAT3 Antibody
PHY1535A 150 μg

CAT3 Antibody

Sign In for Pricing
View Details
TSCOT Double Nickase Plasmid (m2)
sc-424419-NIC-2 20 µg

TSCOT Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Human KDM4A Protein, N-His
YHB11501 100 μg

Recombinant Human KDM4A Protein, N-His

Sign In for Pricing
View Details
Anti-Hu CD34 Pacific Blue™
PB-297-T100 100 Tests

Anti-Hu CD34 Pacific Blue™

Sign In for Pricing
View Details
Neuromedin S (NMS) (Rat) - Biotin Labeled Purified IgG
B-G-045-87 100 µL

Neuromedin S (NMS) (Rat) - Biotin Labeled Purified IgG

Sign In for Pricing
View Details