Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanococcus aeolicus Undecaprenyl-diphosphatase (uppP)

This Recombinant Methanococcus aeolicus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-255.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Undecaprenyl pyrophosphate phosphatase

UniProt

A6UWS5

Expression Region

1-255

Origin

Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIIQVIVLSIIEGITEFLPISSTGHLIIVSNLMNLAQNAVQTNFEITIQLASIFAVCYE YREKFYNNLELWKKIIISFIPVGIMGLLFHKIVYQLFTVQIVATAFIVGGIIFLIVEKYY KEKEHNIKDLKDISYKQSLLIGIAQAFSLIPGTSRSGATIVGGMLCNLNRKTATEFSFLG ALPVMLAASLFDIVKHHSELGSGDISNLVVGFIVSFFMALITIRLFLKYIEKYNFVPFGI YRILFGVILLMFFVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC15A1 (C-term) Rabbit Polyclonal Antibody
AP08316PU-N 50 µg

SLC15A1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS708026 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Recombinant ACSS2 Antibody
RC-4209-01 50 μL

Recombinant ACSS2 Antibody

Sign In for Pricing
View Details
Recombinant ACSS2 Antibody
RC-4209-02 100 µL

Recombinant ACSS2 Antibody

Sign In for Pricing
View Details
Recombinant ACSS2 Antibody
RC-4209-03 1 mL

Recombinant ACSS2 Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR560961 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details