Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella denitrificans Cobalamin synthase (cobS)

This Recombinant Shewanella denitrificans Cobalamin synthase (cobS) spans the amino acid sequence from region 1-262.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

Q12Q70

Expression Region

1-262

Origin

Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNEYNWLRQLNLFFVATGFFTRLPTPSWVIADDNELKKSSRYFGLVGLLIGLICALVYW FTQQWLPTSVAVLLAMVAGVLVTGGFHEDGLADTADGFLGGKTFEDKLRIMKDNHLGSYG AIVLALILLLRWQLLVELALFSPWAAITGFIVAHTLSRVLAASLIFSVKYVTDLELEEGK RLSHDQSLNDLFILLASGIFVLFWLNGLAAFVLFISLWALRFCLCKYFRSQIGGYTGDTL DAAQQVSEIMCYLIILAVGLSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclin D2 (CCND2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D6]
TA806315BM 100 µL

Cyclin D2 (CCND2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D6]

Sign In for Pricing
View Details
FK-866 HCl
SIH-354-25MG 25 mg

FK-866 HCl

Sign In for Pricing
View Details
Ap2s1 Mouse Gene Knockout Kit (CRISPR)
KN501363 1 Kit

Ap2s1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-Ethylbenzylamine
TRC-E899965-1ML 1 mL

N-Ethylbenzylamine

Sign In for Pricing
View Details
MRPS25 Mouse Monoclonal Antibody [Clone ID: AT38E7]
AM50043PU-S 50 µL

MRPS25 Mouse Monoclonal Antibody [Clone ID: AT38E7]

Sign In for Pricing
View Details
Epstein-Barr Virus (EBV) TaqMan PCR Lyophilized
TM41010L 100 Reactions

Epstein-Barr Virus (EBV) TaqMan PCR Lyophilized

Sign In for Pricing
View Details