Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. ATP synthase subunit a (atpB)

This Recombinant Shewanella sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q0HPF5

Expression Region

1-264

Origin

Shewanella sp. (strain MR-7)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATGEALTPQGYIQHHLTNLHVGEGFWTWHIDSLFFSVGLGVLFLWIFRSVGKKATSGV PGKLQCFIEMIVEFVDNSVKESFHGRNALIAPLALTIFVWVFMMNFMDMLPVDWLPWLAS LAGVPYLKVVPTTDVNITFSLAIGVFVLIIYYSIKVKGVSGFVKELTLQPFNHKAMIPVN LLLETVTLIAKPISLALRLFGNLYAGELIFILIALMYGTNLLLSSLGVTLQLGWLIFHIL VITLQAFIFMMLTIVYLSMAHEDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3,6-dichloro-2-fluorophenyl) (phenyl) methanol
PC1021157-01 250 mg

(3,6-dichloro-2-fluorophenyl) (phenyl) methanol

Sign In for Pricing
View Details
(3,6-dichloro-2-fluorophenyl) (phenyl) methanol
PC1021157-02 500 mg

(3,6-dichloro-2-fluorophenyl) (phenyl) methanol

Sign In for Pricing
View Details
(3,6-dichloro-2-fluorophenyl) (phenyl) methanol
PC1021157-03 1 g

(3,6-dichloro-2-fluorophenyl) (phenyl) methanol

Sign In for Pricing
View Details
Lentiviral mouse Gtf2f1 shRNA (UAS) - Lentiviral mouse Gtf2f1 shRNA (UAS, GFP) plasmid
GTR15287650 1 Vial

Lentiviral mouse Gtf2f1 shRNA (UAS) - Lentiviral mouse Gtf2f1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Chicken Neuropeptide A ELISA Kit
GTR10342350 96 Well

Chicken Neuropeptide A ELISA Kit

Sign In for Pricing
View Details
MYDGF Rabbit Polyclonal Antibody (Biotin)
orb2093020 100 µL

MYDGF Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details