Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. ATP synthase subunit a (atpB)

This Recombinant Shewanella sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-264.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q0HPF5

Expression Region

1-264

Origin

Shewanella sp. (strain MR-7)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAATGEALTPQGYIQHHLTNLHVGEGFWTWHIDSLFFSVGLGVLFLWIFRSVGKKATSGV PGKLQCFIEMIVEFVDNSVKESFHGRNALIAPLALTIFVWVFMMNFMDMLPVDWLPWLAS LAGVPYLKVVPTTDVNITFSLAIGVFVLIIYYSIKVKGVSGFVKELTLQPFNHKAMIPVN LLLETVTLIAKPISLALRLFGNLYAGELIFILIALMYGTNLLLSSLGVTLQLGWLIFHIL VITLQAFIFMMLTIVYLSMAHEDH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GOLPH4 Antibody (7V683)
TMAB-06638-01 25 µL

Anti-GOLPH4 Antibody (7V683)

Sign In for Pricing
View Details
Anti-GOLPH4 Antibody (7V683)
TMAB-06638-02 50 μL

Anti-GOLPH4 Antibody (7V683)

Sign In for Pricing
View Details
Anti-GOLPH4 Antibody (7V683)
TMAB-06638-03 100 µL

Anti-GOLPH4 Antibody (7V683)

Sign In for Pricing
View Details
Catsper2 3'UTR GFP Stable Cell Line
TU251696 1.0 mL

Catsper2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Cystatin 8 (m) -PR
sc-142756-PR 10 µM - 20 µL

Cystatin 8 (m) -PR

Sign In for Pricing
View Details
DnaJ homolog subfamily A member 1 (DNAJA1) Mouse ELISA Kit
C9689 96 Tests

DnaJ homolog subfamily A member 1 (DNAJA1) Mouse ELISA Kit

Sign In for Pricing
View Details